Lineage for d3o6ca_ (3o6c A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1826370Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 1826416Family c.1.24.0: automated matches [191640] (1 protein)
    not a true family
  6. 1826417Protein automated matches [191177] (3 species)
    not a true protein
  7. 1826427Species Campylobacter jejuni [TaxId:192222] [189430] (2 PDB entries)
  8. 1826428Domain d3o6ca_: 3o6c A: [182834]
    automated match to d1ho1a_
    complexed with po4

Details for d3o6ca_

PDB Entry: 3o6c (more details), 1.87 Å

PDB Description: pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni
PDB Compounds: (A:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d3o6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6ca_ c.1.24.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
namllgvnidhiavlrqarmvndpdlleaafivarhgdqitlhvredrrhaqdfdlenii
kfckspvnlecalndeilnlalklkphrvtlvpekreelttegglclnhaklkqsieklq
nanievslfinpslediekskilkaqfielhtghyanlhnalfsnishtafalkeldqdk
ktlqaqfekelqnlelcakkglelglkvaaghglnyknvkpvvkikeicelnigqsivar
svftglqnailemkelikr

SCOPe Domain Coordinates for d3o6ca_:

Click to download the PDB-style file with coordinates for d3o6ca_.
(The format of our PDB-style files is described here.)

Timeline for d3o6ca_: