![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) ![]() |
![]() | Family a.209.1.0: automated matches [191592] (1 protein) not a true family |
![]() | Protein automated matches [191071] (2 species) not a true protein |
![]() | Species Azospirillum brasilense [TaxId:192] [188978] (2 PDB entries) |
![]() | Domain d3o5ta_: 3o5t A: [182815] Other proteins in same PDB: d3o5tb_ automated match to d1t5ja_ complexed with adp, mg |
PDB Entry: 3o5t (more details), 2.09 Å
SCOPe Domain Sequences for d3o5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5ta_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]} dhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddt emsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepesey hagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggd vrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqgg dadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
Timeline for d3o5ta_: