![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
![]() | Protein automated matches [226834] (4 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [224865] (2 PDB entries) |
![]() | Domain d3o13a1: 3o13 A:34-124 [214113] Other proteins in same PDB: d3o13a2 automated match to d1v1pa1 complexed with cl, edo |
PDB Entry: 3o13 (more details), 2.05 Å
SCOPe Domain Sequences for d3o13a1:
Sequence, based on SEQRES records: (download)
>d3o13a1 b.40.2.0 (A:34-124) automated matches {Staphylococcus aureus [TaxId: 158878]} evrsqatqdlseyykgrgfeltnvtgykygnkvtfidnsqqidvtltgnekltvkdddev snvdvfvvregsdksaittsiggitktngtq
>d3o13a1 b.40.2.0 (A:34-124) automated matches {Staphylococcus aureus [TaxId: 158878]} evrsqatqdlseyykgrgfeltnvtgykygnkvtfidnsqqidvtltgnekltvkdddev snvdvfvvregssaittsiggitktngtq
Timeline for d3o13a1: