Lineage for d3o04a1 (3o04 A:1-251)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (3 families) 
Family c.95.1.0: automated matches [196908] (1 protein)
not a true familyProtein automated matches [196909] (83 species)
not a true protein
Species Listeria monocytogenes [TaxId:169963] [225947] (1 PDB entry) 
Domain d3o04a1: 3o04 A:1-251 [214096]
automated match to d2alma1
Details for d3o04a1
PDB Entry: 3o04 (more details), 1.85 Å
PDB Description: crystal structure of the beta-keto-acyl carrier protein synthase ii (lmo2201) from listeria monocytogenes
PDB Compounds: (A:) beta-keto-acyl carrier protein synthase IISCOPe Domain Sequences for d3o04a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o04a1 c.95.1.0 (A:1-251) automated matches {Listeria monocytogenes [TaxId: 169963]}
mdkrrvvvtgigavtpigndaetswenakkgvngvakmtrlnpddfpvkiaaelkdfdve
kylekkearkmdrfthyaiasaemavqdsglviddsnanrvgvwigsgiggmetfetqye
iflnrghrrvspffvpmmipdmgsgqvsirfgakginsttvtacatatnsigdafkvier
gdadamitggaeapitkmslagftankalslnpdpetacrpfdkdrdgfiigegagivil
eeyehakarga
SCOPe Domain Coordinates for d3o04a1:
Click to download the PDB-style file with coordinates for d3o04a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3o04a1:
- d3o04a1 first appeared in SCOPe 2.03
- d3o04a1 appears in SCOPe 2.07
View in 3D
