Lineage for d3o04a1 (3o04 A:1-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917764Species Listeria monocytogenes [TaxId:169963] [225947] (1 PDB entry)
  8. 2917765Domain d3o04a1: 3o04 A:1-251 [214096]
    automated match to d2alma1

Details for d3o04a1

PDB Entry: 3o04 (more details), 1.85 Å

PDB Description: crystal structure of the beta-keto-acyl carrier protein synthase ii (lmo2201) from listeria monocytogenes
PDB Compounds: (A:) beta-keto-acyl carrier protein synthase II

SCOPe Domain Sequences for d3o04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o04a1 c.95.1.0 (A:1-251) automated matches {Listeria monocytogenes [TaxId: 169963]}
mdkrrvvvtgigavtpigndaetswenakkgvngvakmtrlnpddfpvkiaaelkdfdve
kylekkearkmdrfthyaiasaemavqdsglviddsnanrvgvwigsgiggmetfetqye
iflnrghrrvspffvpmmipdmgsgqvsirfgakginsttvtacatatnsigdafkvier
gdadamitggaeapitkmslagftankalslnpdpetacrpfdkdrdgfiigegagivil
eeyehakarga

SCOPe Domain Coordinates for d3o04a1:

Click to download the PDB-style file with coordinates for d3o04a1.
(The format of our PDB-style files is described here.)

Timeline for d3o04a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o04a2