Lineage for d3nz1a_ (3nz1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1816266Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1816398Protein automated matches [190053] (8 species)
    not a true protein
  7. 1816424Species Sulfolobus solfataricus [TaxId:2287] [190005] (7 PDB entries)
  8. 1816428Domain d3nz1a_: 3nz1 A: [182636]
    automated match to d1a53a_
    complexed with 3ny, so4, tla

Details for d3nz1a_

PDB Entry: 3nz1 (more details), 1.56 Å

PDB Description: Crystal Structure of Kemp Elimination Catalyst 1A53-2 Complexed with Transition State Analog 5-Nitro Benzotriazole
PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d3nz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nz1a_ c.1.2.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgld
verdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqidd
aynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieias
rdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnpe
kikefilgs

SCOPe Domain Coordinates for d3nz1a_:

Click to download the PDB-style file with coordinates for d3nz1a_.
(The format of our PDB-style files is described here.)

Timeline for d3nz1a_: