Lineage for d3nxfa_ (3nxf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1816266Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1816398Protein automated matches [190053] (8 species)
    not a true protein
  7. 1816399Species Artificial gene [TaxId:32630] [188991] (7 PDB entries)
  8. 1816405Domain d3nxfa_: 3nxf A: [182610]
    automated match to d1a53a_
    complexed with so4

Details for d3nxfa_

PDB Entry: 3nxf (more details), 2.4 Å

PDB Description: robust computational design, optimization, and structural characterization of retroaldol enzymes
PDB Compounds: (A:) Retro-Aldolase

SCOPe Domain Sequences for d3nxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nxfa_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiatymrkspwgld
verdpieyakfmeryavglsicteekyangsyetlrkiassvsipilmadfivkesqidd
aynlgadtvplivkiltereleslleyarsygmepiixindendldialrigarfigics
rdwetleinkenqrklismipsnvvkvastgiserneieelrklgvnafsiisslmrnpe
kikelieg

SCOPe Domain Coordinates for d3nxfa_:

Click to download the PDB-style file with coordinates for d3nxfa_.
(The format of our PDB-style files is described here.)

Timeline for d3nxfa_: