Lineage for d3nwga2 (3nwg A:94-179)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562793Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2562794Protein automated matches [195117] (12 species)
    not a true protein
  7. 2562818Species Desulfitobacterium hafniense [TaxId:272564] [340495] (1 PDB entry)
  8. 2562820Domain d3nwga2: 3nwg A:94-179 [340497]
    Other proteins in same PDB: d3nwga3
    automated match to d3n79a2
    complexed with gol

Details for d3nwga2

PDB Entry: 3nwg (more details), 2.7 Å

PDB Description: the crystal structure of a microcomparments protein from desulfitobacterium hafniense dcb
PDB Compounds: (A:) Microcompartments protein

SCOPe Domain Sequences for d3nwga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nwga2 d.58.56.0 (A:94-179) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
kalgiietfsiaslivaadtaaktgqvdlveirigmgiggksfvtltgdvasvessvaag
vmlasergmlvdkvvipsphdhlkrc

SCOPe Domain Coordinates for d3nwga2:

Click to download the PDB-style file with coordinates for d3nwga2.
(The format of our PDB-style files is described here.)

Timeline for d3nwga2: