| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
| Protein automated matches [195117] (12 species) not a true protein |
| Species Desulfitobacterium hafniense [TaxId:272564] [340495] (1 PDB entry) |
| Domain d3nwga2: 3nwg A:94-179 [340497] Other proteins in same PDB: d3nwga3 automated match to d3n79a2 complexed with gol |
PDB Entry: 3nwg (more details), 2.7 Å
SCOPe Domain Sequences for d3nwga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nwga2 d.58.56.0 (A:94-179) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
kalgiietfsiaslivaadtaaktgqvdlveirigmgiggksfvtltgdvasvessvaag
vmlasergmlvdkvvipsphdhlkrc
Timeline for d3nwga2: