Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer |
Protein automated matches [190924] (1 species) not a true protein |
Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries) |
Domain d3nw4a_: 3nw4 A: [196330] automated match to d2phdb_ complexed with fe2, gol, gtq; mutant |
PDB Entry: 3nw4 (more details), 2 Å
SCOPe Domain Sequences for d3nw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nw4a_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]} kldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstl lrlarksgelvpvgrggerralglanpglggnayisptmwaaiqylgpretapehrhsqn afrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqm dvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralte qllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfq vfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtki egq
Timeline for d3nw4a_: