Lineage for d3nsgc_ (3nsg C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627627Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2627702Protein automated matches [190289] (7 species)
    not a true protein
  7. 2627774Species Salmonella enterica [TaxId:527001] [193694] (2 PDB entries)
  8. 2627777Domain d3nsgc_: 3nsg C: [193695]
    automated match to d2zfga_
    complexed with flc, gol, lda, so4, tam, tla

Details for d3nsgc_

PDB Entry: 3nsg (more details), 2.79 Å

PDB Description: crystal structure of ompf, an outer membrane protein from salmonella typhi
PDB Compounds: (C:) Outer membrane protein F

SCOPe Domain Sequences for d3nsgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nsgc_ f.4.3.1 (C:) automated matches {Salmonella enterica [TaxId: 527001]}
meiynkdgnkldlygkavgrhvwtttgdsknadqtyaqigfkgetqintdltgfgqweyr
tkadraegeqqnsnlvrlafaglkyaevgsidygrnygivydvesytdmapyfsgetwgg
aytdnymtsragglltyrnsdffglvdglsfgiqyqgknqdnhsinsqngdgvgytmaye
fdgfgvtaaysnskrtndqqdrdgngdraesravgakydannvylaavyaetrnmsiven
tvtdtvemanktqnlevvaqyqfdfglrpaisyvqskgkqlngaggsadlakyiqagaty
yfnknmnvwvdyrfnlldendysssyvgtddqaavgityqf

SCOPe Domain Coordinates for d3nsgc_:

Click to download the PDB-style file with coordinates for d3nsgc_.
(The format of our PDB-style files is described here.)

Timeline for d3nsgc_: