![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.3: Porins [56935] (5 families) ![]() |
![]() | Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
![]() | Protein automated matches [190289] (7 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:527001] [193694] (2 PDB entries) |
![]() | Domain d3nsga_: 3nsg A: [199972] automated match to d3nsgc_ complexed with flc, gol, lda, so4, tam, tla |
PDB Entry: 3nsg (more details), 2.79 Å
SCOPe Domain Sequences for d3nsga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nsga_ f.4.3.1 (A:) automated matches {Salmonella enterica [TaxId: 527001]} meiynkdgnkldlygkavgrhvwtttgdsknadqtyaqigfkgetqintdltgfgqweyr tkadraegeqqnsnlvrlafaglkyaevgsidygrnygivydvesytdmapyfsgetwgg aytdnymtsragglltyrnsdffglvdglsfgiqyqgknqdnhsinsqngdgvgytmaye fdgfgvtaaysnskrtndqqdrdgngdraesravgakydannvylaavyaetrnmsiven tvtdtvemanktqnlevvaqyqfdfglrpaisyvqskgkqlngaggsadlakyiqagaty yfnknmnvwvdyrfnlldendysssyvgtddqaavgityqf
Timeline for d3nsga_: