Lineage for d3njea_ (3nje A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.24: Pili subunits [54522] (1 superfamily)
contains very long N-terminal helix, which end is packed against beta-sheetSuperfamily d.24.1: Pili subunits [54523] (8 families) 
bacterial filament proteins
Family d.24.1.0: automated matches [233575] (1 protein)
not a true familyProtein automated matches [233576] (3 species)
not a true proteinSpecies Pseudomonas aeruginosa [TaxId:287] [255339] (5 PDB entries) 
Domain d3njea_: 3nje A: [247946]
automated match to d3ci0j1
Details for d3njea_
PDB Entry: 3nje (more details), 1.85 Å
PDB Description: structure of the minor pseudopilin xcpw from the pseudomonas aeruginosa type ii secretion system
PDB Compounds: (A:) General secretion pathway protein JSCOPe Domain Sequences for d3njea_:
Sequence, based on SEQRES records: (download)
>d3njea_ d.24.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
rvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrnp
lgqarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwq
ghwptdegseeerleslplavemtlehrhygklvrvwrlldpplkq
Sequence, based on observed residues (ATOM records): (download)
>d3njea_ d.24.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
rvqeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwlqr
vrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqghwptdegse
eerleslplavemtlehrhygklvrvwrlldpplkq
SCOPe Domain Coordinates for d3njea_:
Click to download the PDB-style file with coordinates for d3njea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3njea_:
- d3njea_ first appeared in SCOPe 2.04
- d3njea_ appears in SCOPe 2.07
View in 3D
