Lineage for d3ni6b_ (3ni6 B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.0: automated matches [191631] (1 protein)
not a true familyProtein automated matches [191162] (11 species)
not a true protein
Species Plasmodium vivax [TaxId:5855] [189364] (4 PDB entries) 
Domain d3ni6b_: 3ni6 B: [182312]
automated match to d1r9ha_
complexed with gol
Details for d3ni6b_
PDB Entry: 3ni6 (more details), 1.42 Å
PDB Description: Crystal structure of the FK506 binding domain of Plasmodium vivax FKBP35
PDB Compounds: (B:) 70 kDa peptidylprolyl isomeraseSCOPe Domain Sequences for d3ni6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ni6b_ d.26.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 5855]}
leqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernvpfk
fhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeielisfr
e
SCOPe Domain Coordinates for d3ni6b_:
Click to download the PDB-style file with coordinates for d3ni6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ni6b_:
- d3ni6b_ first appeared in SCOPe 2.01
- d3ni6b_ appears in SCOPe 2.02
- d3ni6b_ appears in SCOPe 2.04
- d3ni6b_ appears in the current release, SCOPe 2.08
View in 3D
