Lineage for d3ni6a_ (3ni6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941826Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries)
  8. 2941827Domain d3ni6a_: 3ni6 A: [182311]
    automated match to d1r9ha_
    complexed with gol

Details for d3ni6a_

PDB Entry: 3ni6 (more details), 1.42 Å

PDB Description: Crystal structure of the FK506 binding domain of Plasmodium vivax FKBP35
PDB Compounds: (A:) 70 kDa peptidylprolyl isomerase

SCOPe Domain Sequences for d3ni6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ni6a_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
qetleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernv
pfkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeieli
sfre

SCOPe Domain Coordinates for d3ni6a_:

Click to download the PDB-style file with coordinates for d3ni6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ni6a_: