| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (29 species) not a true protein |
| Species Plasmodium vivax [TaxId:5855] [189364] (5 PDB entries) |
| Domain d3ni6a_: 3ni6 A: [182311] automated match to d1r9ha_ complexed with gol |
PDB Entry: 3ni6 (more details), 1.42 Å
SCOPe Domain Sequences for d3ni6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ni6a_ d.26.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
qetleqvhltedggvvktilrkgeggeenapkkgnevtvhyvgklessgkvfdssrernv
pfkfhlgqgevikgwdicvasmtknekcsvrldskygygeegcgesipgnsvlifeieli
sfre
Timeline for d3ni6a_: