Lineage for d3ngbk2 (3ngb K:108-216)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765800Domain d3ngbk2: 3ngb K:108-216 [213931]
    automated match to d1z3gl2
    complexed with bgc, nag, trs

Details for d3ngbk2

PDB Entry: 3ngb (more details), 2.68 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 gp120
PDB Compounds: (K:) Antigen binding fragment of light chain: Antibody VRC01

SCOPe Domain Sequences for d3ngbk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngbk2 b.1.1.0 (K:108-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOPe Domain Coordinates for d3ngbk2:

Click to download the PDB-style file with coordinates for d3ngbk2.
(The format of our PDB-style files is described here.)

Timeline for d3ngbk2: