Lineage for d3nfwa_ (3nfw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794398Species Mycobacterium thermoresistibile [TaxId:1078020] [267858] (1 PDB entry)
  8. 2794399Domain d3nfwa_: 3nfw A: [265084]
    Other proteins in same PDB: d3nfwb2, d3nfwd2
    automated match to d4r82a_
    complexed with gol

Details for d3nfwa_

PDB Entry: 3nfw (more details), 1.6 Å

PDB Description: crystal structure of nitrilotriacetate monooxygenase component b (a0r521 homolog) from mycobacterium thermoresistibile
PDB Compounds: (A:) Flavin reductase-like, FMN-binding protein

SCOPe Domain Sequences for d3nfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nfwa_ b.45.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
aeaidqrtfrrvlgqfctgvtiittvhegnpvgfacqsfaalsldpplvlfcptkvsrsw
kaieasgrfcvnilhekqqhvsarfgsrepdkfagidwrpsdlgspiidgslahidctvh
dvhdggdhfvvfgkvhglsevperkprpllfyrgeytgiepekntpaqwrddleaflta

SCOPe Domain Coordinates for d3nfwa_:

Click to download the PDB-style file with coordinates for d3nfwa_.
(The format of our PDB-style files is described here.)

Timeline for d3nfwa_: