Lineage for d3ndza_ (3ndz A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. Protein automated matches [190075] (131 species)
    not a true protein
  7. Species Clostridium cellulovorans [TaxId:1493] [311320] (3 PDB entries)
  8. Domain d3ndza_: 3ndz A: [306035]
    Other proteins in same PDB: d3ndze_, d3ndzf_, d3ndzg_, d3ndzh_
    automated match to d4im4a_

Details for d3ndza_

PDB Entry: 3ndz (more details), 2.08 Å

PDB Description: the structure of the catalytic and carbohydrate binding domain of endoglucanase d from clostridium cellulovorans bound to cellotriose
PDB Compounds: (A:) Endoglucanase D

SCOPe Domain Sequences for d3ndza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndza_ c.1.8.0 (A:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss

SCOPe Domain Coordinates for d3ndza_ are not available.

Timeline for d3ndza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ndzb_, d3ndzc_, d3ndzd_, d3ndze_, d3ndzf_, d3ndzg_, d3ndzh_