Lineage for d3ndob_ (3ndo B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structure
Family c.1.10.0: automated matches [191319] (1 protein)
not a true familyProtein automated matches [190115] (75 species)
not a true protein
Species Mycobacterium smegmatis [TaxId:1772] [196434] (1 PDB entry) 
Domain d3ndob_: 3ndo B: [196435]
automated match to d3ng3a_
complexed with gol, nh4, unl
Details for d3ndob_
PDB Entry: 3ndo (more details), 1.25 Å
PDB Description: crystal structure of deoxyribose phosphate aldolase from mycobacterium smegmatis
PDB Compounds: (B:) deoxyribose-phosphate aldolaseSCOPe Domain Sequences for d3ndob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ndob_ c.1.10.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
dhtraqvaalvdhtllkpeatpsdvtalvdeaadlgvfavcvspplvsvaagvapsglai
aavagfpsgkhvpgikateaelavaagateidmvidvgaalagdldavsaditavrkavr
aatlkvivesaallefsgeplladvcrvardagadfvktstgfhpsggasvqaveimart
vgerlgvkasggirtaeqaaamldagatrlglsgsravldgfgsa
SCOPe Domain Coordinates for d3ndob_:
Click to download the PDB-style file with coordinates for d3ndob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ndob_:
- d3ndob_ first appeared in SCOPe 2.02
- d3ndob_ appears in SCOPe 2.05
- d3ndob_ appears in SCOPe 2.07
- d3ndob_ appears in the current release, SCOPe 2.08
View in 3D
