Lineage for d3ndja_ (3ndj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894378Family c.66.1.60: C-3'-methyltransferase-like [310657] (2 proteins)
    Pfam PF08421; Pfam PF13489; Pfam PF08484 (in that order in the sequence)
  6. 2894379Protein TcaB9 [310820] (1 species)
  7. 2894380Species Micromonospora chalcea [TaxId:1874] [311087] (10 PDB entries)
  8. 2894387Domain d3ndja_: 3ndj A: [306030]
    complexed with jhz, po4, sah, zn

Details for d3ndja_

PDB Entry: 3ndj (more details), 1.5 Å

PDB Description: X-ray Structure of a C-3'-Methyltransferase in Complex with S-Adenosyl-L-Homocysteine and Sugar Product
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d3ndja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndja_ c.66.1.60 (A:) TcaB9 {Micromonospora chalcea [TaxId: 1874]}
ptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprd
lmfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvr
hlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlchipyvqsvl
egvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgmaqrcgfelvdvq
rlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltal
lhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpas
afsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir

SCOPe Domain Coordinates for d3ndja_:

Click to download the PDB-style file with coordinates for d3ndja_.
(The format of our PDB-style files is described here.)

Timeline for d3ndja_: