Lineage for d3n8da1 (3n8d A:2-128)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
possible rudiment form of Rossmann-fold domainSuperfamily c.30.1: PreATP-grasp domain [52440] (10 families) 
precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
Family c.30.1.0: automated matches [227183] (1 protein)
not a true familyProtein automated matches [226903] (35 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [225145] (3 PDB entries) 
Domain d3n8da1: 3n8d A:2-128 [213785]
Other proteins in same PDB: d3n8da2, d3n8db2, d3n8db3
automated match to d1ehib1
complexed with anp, cl, so4
Details for d3n8da1
PDB Entry: 3n8d (more details), 2.3 Å
PDB Description: Crystal structure of Staphylococcus aureus VRSA-9 D-Ala:D-Ala ligase
PDB Compounds: (A:) d-alanine--d-alanine ligaseSCOPe Domain Sequences for d3n8da1:
Sequence, based on SEQRES records: (download)
>d3n8da1 c.30.1.0 (A:2-128) automated matches {Staphylococcus aureus [TaxId: 1280]}
tkenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeiks
tdelhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngv
lsaassm
Sequence, based on observed residues (ATOM records): (download)
>d3n8da1 c.30.1.0 (A:2-128) automated matches {Staphylococcus aureus [TaxId: 1280]}
tkenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeiks
tdelhleleisqllkesssgqpydavfpllngedgtiqglfevldvpyvgngvlsaassm
SCOPe Domain Coordinates for d3n8da1:
Click to download the PDB-style file with coordinates for d3n8da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3n8da1:
- d3n8da1 first appeared in SCOPe 2.03
- d3n8da1 appears in SCOPe 2.05
- d3n8da1 appears in SCOPe 2.07
- d3n8da1 appears in the current release, SCOPe 2.08
View in 3D
