Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (13 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [225986] (2 PDB entries) |
Domain d3n79a1: 3n79 A:2-94 [306021] automated match to d4qiva_ complexed with cl, na, so4; mutant |
PDB Entry: 3n79 (more details), 1.5 Å
SCOPe Domain Sequences for d3n79a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n79a1 d.58.56.0 (A:2-94) automated matches {Salmonella enterica [TaxId: 90371]} sqaigileltsiakgmelgdamlksanvdllvsktispgkfllmlggdigaiqqaietgt sqagemlvdslvlanihpsvlpaisglnsvdkr
Timeline for d3n79a1: