Lineage for d3n79a1 (3n79 A:2-94)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.56: CcmK-like [143414] (2 families) 
contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
Family d.58.56.0: automated matches [195116] (1 protein)
not a true familyProtein automated matches [195117] (13 species)
not a true proteinSpecies Salmonella enterica [TaxId:90371] [225986] (2 PDB entries) 
Domain d3n79a1: 3n79 A:2-94 [306021]
automated match to d4qiva_
complexed with cl, na, so4; mutant
Details for d3n79a1
PDB Entry: 3n79 (more details), 1.5 Å
PDB Description: pdut c38s mutant from salmonella enterica typhimurium
PDB Compounds: (A:) PduTSCOPe Domain Sequences for d3n79a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n79a1 d.58.56.0 (A:2-94) automated matches {Salmonella enterica [TaxId: 90371]}
sqaigileltsiakgmelgdamlksanvdllvsktispgkfllmlggdigaiqqaietgt
sqagemlvdslvlanihpsvlpaisglnsvdkr
SCOPe Domain Coordinates for d3n79a1:
Click to download the PDB-style file with coordinates for d3n79a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3n79a1:
- d3n79a1 first appeared in SCOPe 2.06
- d3n79a1 appears in SCOPe 2.07
View in 3D
