Lineage for d3n40f1 (3n40 F:-1-292)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252195Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2252196Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2252197Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 2252231Protein automated matches [226969] (3 species)
    not a true protein
  7. 2252232Species Chikungunya virus [TaxId:37124] [226028] (3 PDB entries)
  8. 2252233Domain d3n40f1: 3n40 F:-1-292 [213714]
    Other proteins in same PDB: d3n40f2
    automated match to d2alaa2
    complexed with act, nag

Details for d3n40f1

PDB Entry: 3n40 (more details), 2.17 Å

PDB Description: crystal structure of the immature envelope glycoprotein complex of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoprotein

SCOPe Domain Sequences for d3n40f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n40f1 f.10.1.1 (F:-1-292) automated matches {Chikungunya virus [TaxId: 37124]}
ggyehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipsp
yvkccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktef
asayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkiv
vykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqaps
gfkywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd

SCOPe Domain Coordinates for d3n40f1:

Click to download the PDB-style file with coordinates for d3n40f1.
(The format of our PDB-style files is described here.)

Timeline for d3n40f1: