Lineage for d3n40f1 (3n40 F:-1-292)
- Root: SCOPe 2.06
Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) 
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
2 intertwined domains; all-beta and alpha+betaSuperfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) 
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) 
Protein automated matches [226969] (3 species)
not a true proteinSpecies Chikungunya virus [TaxId:37124] [226028] (3 PDB entries) 
Domain d3n40f1: 3n40 F:-1-292 [213714]
Other proteins in same PDB: d3n40f2
automated match to d2alaa2
complexed with act, nag
Details for d3n40f1
PDB Entry: 3n40 (more details), 2.17 Å
PDB Description: crystal structure of the immature envelope glycoprotein complex of chikungunya virus.
PDB Compounds: (F:) e1 envelope glycoproteinSCOPe Domain Sequences for d3n40f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n40f1 f.10.1.1 (F:-1-292) automated matches {Chikungunya virus [TaxId: 37124]}
ggyehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipsp
yvkccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktef
asayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkiv
vykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqaps
gfkywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvd
SCOPe Domain Coordinates for d3n40f1:
Click to download the PDB-style file with coordinates for d3n40f1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3n40f1:
- d3n40f1 first appeared in SCOPe 2.03
- d3n40f1 appears in SCOPe 2.05
- d3n40f1 appears in SCOPe 2.07
- d3n40f1 appears in the current release, SCOPe 2.08
View in 3D
