Lineage for d3n2ia_ (3n2i A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
parallel beta-sheet of 5 strands, order 23145
Protein automated matches [190087] (15 species)
not a true protein
Species Vibrio cholerae [TaxId:243277] [225848] (2 PDB entries) 
Domain d3n2ia_: 3n2i A: [213676]
automated match to d4tmka_
complexed with cl, thm
Details for d3n2ia_
PDB Entry: 3n2i (more details), 2.25 Å
PDB Description: 2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
PDB Compounds: (A:) thymidylate kinaseSCOPe Domain Sequences for d3n2ia_:
Sequence, based on SEQRES records: (download)
>d3n2ia_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mnakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpg
eelqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqs
lkqtalgdfkpdltlyldidpklglerargrgeldriekmdisfferarerylelansdd
svvmidaaqsieqvtadirralqdwlsq
Sequence, based on observed residues (ATOM records): (download)
>d3n2ia_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
mnakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpg
eelqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqs
lkqtalgdfkpdltlyldidpklglerargeldriekmdisfferarerylelansddsv
vmidaaqsieqvtadirralqdwlsq
SCOPe Domain Coordinates for d3n2ia_:
Click to download the PDB-style file with coordinates for d3n2ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3n2ia_:
- d3n2ia_ first appeared in SCOPe 2.03
- d3n2ia_ appears in SCOPe 2.07
View in 3D
