Lineage for d3n0fa1 (3n0f A:57-265)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.0: automated matches [227201] (1 protein)
not a true familyProtein automated matches [226931] (12 species)
not a true protein
Species Populus tremula [TaxId:80863] [225927] (2 PDB entries) 
Domain d3n0fa1: 3n0f A:57-265 [213665]
Other proteins in same PDB: d3n0fa2, d3n0fb2
automated match to d1hxga1
Details for d3n0fa1
PDB Entry: 3n0f (more details), 2.7 Å
PDB Description: Crystal Structure of Isoprene Synthase from Grey Poplar Leaves (Populus x canescens)
PDB Compounds: (A:) Isoprene synthaseSCOPe Domain Sequences for d3n0fa1:
Sequence, based on SEQRES records: (download)
>d3n0fa1 a.102.4.0 (A:57-265) automated matches {Populus tremula [TaxId: 80863]}
sadyepnswdydfllssdtdesievykdkakkleaevrreinnekaefltllelidnvqr
lglgyrfesdirraldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdq
ngnflenlkedtkailslyeasflalegenildearvfaishlkelseekigkelaeqvn
halelplhrrtqrleavwsieayrkkeda
Sequence, based on observed residues (ATOM records): (download)
>d3n0fa1 a.102.4.0 (A:57-265) automated matches {Populus tremula [TaxId: 80863]}
sadyepnswdydfllssievykdkakkleaevrreinnekaefltllelidnvqrlglgy
rfesdirraldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnfl
enlkedtkailslyeasflalegenildearvfaishlkelseekigkelaeqvnhalel
plhrrtqrleavwsieayrkkeda
SCOPe Domain Coordinates for d3n0fa1:
Click to download the PDB-style file with coordinates for d3n0fa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3n0fa1:
- d3n0fa1 first appeared in SCOPe 2.03
- d3n0fa1 appears in SCOPe 2.07
View in 3D
