Lineage for d3n07d_ (3n07 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527937Species Vibrio cholerae [TaxId:666] [193720] (1 PDB entry)
  8. 2527941Domain d3n07d_: 3n07 D: [193721]
    automated match to d3n1ua_
    complexed with mg

Details for d3n07d_

PDB Entry: 3n07 (more details), 1.76 Å

PDB Description: structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae
PDB Compounds: (D:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3n07d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n07d_ c.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
stvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvkal
mnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyigd
dlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneldv

SCOPe Domain Coordinates for d3n07d_:

Click to download the PDB-style file with coordinates for d3n07d_.
(The format of our PDB-style files is described here.)

Timeline for d3n07d_: