Lineage for d3myya_ (3myy A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein automated matches [190177] (9 species)
not a true proteinSpecies Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries) 
Domain d3myya_: 3myy A: [181718]
automated match to d1a0oa_
complexed with bef, gol, mn, so4; mutant
Details for d3myya_
PDB Entry: 3myy (more details), 2.1 Å
PDB Description: structure of e. coli chey mutant a113p bound to beryllium fluoride
PDB Compounds: (A:) Chemotaxis protein cheYSCOPe Domain Sequences for d3myya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3myya_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
kifeklgm
SCOPe Domain Coordinates for d3myya_:
Click to download the PDB-style file with coordinates for d3myya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3myya_:
- d3myya_ first appeared in SCOPe 2.01
- d3myya_ appears in SCOPe 2.06
- d3myya_ appears in the current release, SCOPe 2.08
View in 3D
