Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Allochromatium vinosum [TaxId:1049] [189415] (1 PDB entry) |
Domain d3myra_: 3myr A: [181705] Other proteins in same PDB: d3myrb_, d3myrd_, d3myrf_, d3myrh_ automated match to d1h2as_ complexed with cl, f3s, imd, mg, nfv, sf4 |
PDB Entry: 3myr (more details), 2.1 Å
SCOPe Domain Sequences for d3myra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3myra_ e.19.1.0 (A:) automated matches {Allochromatium vinosum [TaxId: 1049]} arrpsviwlsfqectgctesltrahaptledlildfisldyhhtlqaasgeaaeaarlqa mdenrgqylvivdgsipgpdanpgfstvaghsnysilmetvehaaaviavgtcaafgglp qarpnptgamsvmdlvrdkpvinvpgcppipmvitgviahylvfgrlpeldgygrplafy gqsihdrcyrrpfydkglfaesfddegakqgwclyrlgckgpttynacatmkwndgtswp veaghpclgcsepqfwdaggfyepvsvp
Timeline for d3myra_: