Lineage for d3mspa_ (3msp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374559Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2374652Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 2374653Protein Major sperm protein, MSP [49361] (2 species)
  7. 2374659Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)
  8. 2374674Domain d3mspa_: 3msp A: [22343]

Details for d3mspa_

PDB Entry: 3msp (more details)

PDB Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures
PDB Compounds: (A:) major sperm protein

SCOPe Domain Sequences for d3mspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mspa_ b.1.11.2 (A:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl

SCOPe Domain Coordinates for d3mspa_:

Click to download the PDB-style file with coordinates for d3mspa_.
(The format of our PDB-style files is described here.)

Timeline for d3mspa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mspb_