Lineage for d3mspa_ (3msp A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.11: PapD-like [49354] (3 families) 
contains PP switch between strands D and C'
Family b.1.11.2: MSP-like [49360] (4 proteins)
Pfam PF00635
Protein Major sperm protein, MSP [49361] (2 species) 
Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries) 
Domain d3mspa_: 3msp A: [22343]
Details for d3mspa_
PDB Entry: 3msp (more details)
PDB Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures
PDB Compounds: (A:) major sperm proteinSCOPe Domain Sequences for d3mspa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mspa_ b.1.11.2 (A:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl
SCOPe Domain Coordinates for d3mspa_:
Click to download the PDB-style file with coordinates for d3mspa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mspa_:
View in 3D
