Lineage for d3ms8a_ (3ms8 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Xylanase [51488] (6 species) 
Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
intra-cellular xylanase
Domain d3ms8a_: 3ms8 A: [181521]
automated match to d1n82a_
complexed with gol, na
Details for d3ms8a_
PDB Entry: 3ms8 (more details), 1.7 Å
PDB Description: Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus.
PDB Compounds: (A:) Intra-cellular xylanase ixt6SCOPe Domain Sequences for d3ms8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ms8a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
ykgkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndyne
cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhita
ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
nfpvhgrknwpllfdeqhkpkpafwravsv
SCOPe Domain Coordinates for d3ms8a_:
Click to download the PDB-style file with coordinates for d3ms8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ms8a_:
- d3ms8a_ first appeared in SCOPe 2.01
- d3ms8a_ appears in SCOPe 2.05
- d3ms8a_ appears in SCOPe 2.07
- d3ms8a_ appears in the current release, SCOPe 2.08
View in 3D
