Lineage for d3mqma_ (3mqm A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.0: automated matches [191428] (1 protein)
not a true familyProtein automated matches [190615] (7 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries) 
Domain d3mqma_: 3mqm A: [232948]
automated match to d3ljwb_
Details for d3mqma_
PDB Entry: 3mqm (more details), 2.54 Å
PDB Description: Crystal Structure of the Bromodomain of human ASH1L
PDB Compounds: (A:) Probable histone-lysine N-methyltransferase ASH1LSCOPe Domain Sequences for d3mqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mqma_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smevaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlit
iekqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqid
eivget
SCOPe Domain Coordinates for d3mqma_:
Click to download the PDB-style file with coordinates for d3mqma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mqma_:
- d3mqma_ first appeared in SCOPe 2.03
- d3mqma_ appears in SCOPe 2.04
- d3mqma_ is called d3mqma1 in SCOPe 2.06
- d3mqma_ appears in the current release, SCOPe 2.08, called d3mqma1
View in 3D
