Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (27 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries) |
Domain d3mpsa1: 3mps A:2-134 [232941] Other proteins in same PDB: d3mpsa2, d3mpsb2, d3mpsd2, d3mpsf2, d3mpsg2, d3mpsh2, d3mpsi2, d3mpsk2 automated match to d1nnqa1 complexed with fe, feo, peo |
PDB Entry: 3mps (more details), 2 Å
SCOPe Domain Sequences for d3mpsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpsa1 a.25.1.1 (A:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]} vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely rkakekaekgedi
Timeline for d3mpsa1: