Lineage for d3moya_ (3moy A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836507Species Mycobacterium smegmatis [TaxId:246196] [196398] (4 PDB entries)
  8. 1836511Domain d3moya_: 3moy A: [196451]
    automated match to d3q0ja_
    complexed with edo, gol, na, so4, trs

Details for d3moya_

PDB Entry: 3moy (more details), 1.5 Å

PDB Description: crystal structure of probable enoyl-coa hydratase from mycobacterium smegmatis
PDB Compounds: (A:) Probable enoyl-CoA hydratase

SCOPe Domain Sequences for d3moya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ttyttiatsrpvagvglirldrpdalnalnqtleaevldaardfdadleigaivvtgser
afaagadiaemvtltphqarernllsgwdsltqvrkpivaavagyalgggcelamlcdlv
iaadtarfgqpeitlgilpglggtqrltravgkakamdlcltgrsltaeeaervglvsri
vpaadlldealavaqriarmsrpagravkdaineaferplsagmryerdafyamfdthdq
tegmtaflekrtpeftdr

SCOPe Domain Coordinates for d3moya_:

Click to download the PDB-style file with coordinates for d3moya_.
(The format of our PDB-style files is described here.)

Timeline for d3moya_: