Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (42 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [196398] (3 PDB entries) |
Domain d3moya_: 3moy A: [196451] automated match to d3q0ja_ complexed with edo, gol, na, so4, trs |
PDB Entry: 3moy (more details), 1.5 Å
SCOPe Domain Sequences for d3moya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3moya_ c.14.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} ttyttiatsrpvagvglirldrpdalnalnqtleaevldaardfdadleigaivvtgser afaagadiaemvtltphqarernllsgwdsltqvrkpivaavagyalgggcelamlcdlv iaadtarfgqpeitlgilpglggtqrltravgkakamdlcltgrsltaeeaervglvsri vpaadlldealavaqriarmsrpagravkdaineaferplsagmryerdafyamfdthdq tegmtaflekrtpeftdr
Timeline for d3moya_: