![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
![]() | Protein automated matches [190781] (46 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189329] (1 PDB entry) |
![]() | Domain d3mmsa_: 3mms A: [181426] automated match to d1jysa_ complexed with gol, q88 |
PDB Entry: 3mms (more details), 1.6 Å
SCOPe Domain Sequences for d3mmsa_:
Sequence, based on SEQRES records: (download)
>d3mmsa_ c.56.2.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkigiiaampeelaylvqhldnaqeqvvlgntyhtgtivshevvlvesgigkvmsamsva ilavhfqvdalintgsagavaegiavgdvviadklayhdvdvtafgyaygqmaqqplyfe sdktfvaqiqeslsqldqnwhlgliatgdsfvagndkieaikshfpevlavemegaaiaq aahalnlpvlviramsdnanheaniffdefiieagrrsaqvllaflkal
>d3mmsa_ c.56.2.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkigiiaampeelaylvqhldnaqeqvvlgntyhtgtivshevvlvesgigkvmsamsva ilavhfqvdalintgsagavaegiavgdvviadklayhdvdvtafgyaygqmaqqplyfe sdktfvaqiqeslqnwhlgliatgdsfvagndkieaikshfpevlavemegaaiaqaaha lnlpvlviramsdnanheaniffdefiieagrrsaqvllaflkal
Timeline for d3mmsa_: