Lineage for d3miwd_ (3miw D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040155Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 3040156Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 3040163Protein automated matches [254616] (6 species)
    not a true protein
  7. 3040177Species Human rotavirus g4 [TaxId:10960] [255969] (1 PDB entry)
  8. 3040181Domain d3miwd_: 3miw D: [247717]
    automated match to d1g1ja_
    complexed with edo

Details for d3miwd_

PDB Entry: 3miw (more details), 2.5 Å

PDB Description: Crystal Structure of Rotavirus NSP4
PDB Compounds: (D:) Non-structural glycoprotein 4

SCOPe Domain Sequences for d3miwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3miwd_ h.1.13.1 (D:) automated matches {Human rotavirus g4 [TaxId: 10960]}
mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrp

SCOPe Domain Coordinates for d3miwd_:

Click to download the PDB-style file with coordinates for d3miwd_.
(The format of our PDB-style files is described here.)

Timeline for d3miwd_: