Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cell division protein kinase 9, CDK9 [160810] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries) Uniprot P50750 8-325 |
Domain d3miaa_: 3mia A: [247709] Other proteins in same PDB: d3miab1, d3miab2 automated match to d3mi9a_ complexed with anp, mg, zn |
PDB Entry: 3mia (more details), 3 Å
SCOPe Domain Sequences for d3miaa_:
Sequence, based on SEQRES records: (download)
>d3miaa_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd dalnhdffwsdpmpsdlkgmlsthltsmfeyla
>d3miaa_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyr ppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpn vdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdff wsdpmpsdlkgmlsthltsmfeyla
Timeline for d3miaa_: