Lineage for d3mdfa_ (3mdf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195515Domain d3mdfa_: 3mdf A: [181019]
    automated match to d2cqba1

Details for d3mdfa_

PDB Entry: 3mdf (more details), 1.85 Å

PDB Description: Crystal structure of the RRM domain of Cyclophilin 33
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d3mdfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdfa_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
aaaidnmneselfgrtirvnlak

SCOPe Domain Coordinates for d3mdfa_:

Click to download the PDB-style file with coordinates for d3mdfa_.
(The format of our PDB-style files is described here.)

Timeline for d3mdfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mdfb_