Lineage for d3md1b_ (3md1 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)
  8. 2952475Domain d3md1b_: 3md1 B: [181014]
    Other proteins in same PDB: d3md1a2
    automated match to d1x5sa1
    complexed with gol

Details for d3md1b_

PDB Entry: 3md1 (more details), 1.6 Å

PDB Description: Crystal Structure of the Second RRM Domain of Yeast Poly(U)-Binding Protein (Pub1)
PDB Compounds: (B:) Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1

SCOPe Domain Sequences for d3md1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3md1b_ d.58.7.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam
dsmqgqdlngrplrinwaa

SCOPe Domain Coordinates for d3md1b_:

Click to download the PDB-style file with coordinates for d3md1b_.
(The format of our PDB-style files is described here.)

Timeline for d3md1b_: