Lineage for d3mcfb_ (3mcf B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.1: MutT-like [55812] (17 proteins) 
Protein automated matches [190465] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189707] (9 PDB entries) 
Domain d3mcfb_: 3mcf B: [196459]
automated match to d2duka_
complexed with flc, gol
Details for d3mcfb_
PDB Entry: 3mcf (more details), 2 Å
PDB Description: crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha
PDB Compounds: (B:) Diphosphoinositol polyphosphate phosphohydrolase 3-alphaSCOPe Domain Sequences for d3mcfb_:
Sequence, based on SEQRES records: (download)
>d3mcfb_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk
lgrllgvfeqnqdpehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpv
haeyleklk
Sequence, based on observed residues (ATOM records): (download)
>d3mcfb_ d.113.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkraaclcfrseredevllvsssrypdrwivpgggmepeeepggaavrevyeeagvkgk
lgrllgvfehrtyvyvltvtelledwedsvsigrkrewfkvedaikvlqchkpvhaeyle
klk
SCOPe Domain Coordinates for d3mcfb_:
Click to download the PDB-style file with coordinates for d3mcfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mcfb_:
- d3mcfb_ first appeared in SCOPe 2.02
- d3mcfb_ appears in SCOPe 2.04
- d3mcfb_ is called d3mcfb1 in SCOPe 2.06
- d3mcfb_ appears in the current release, SCOPe 2.08, called d3mcfb1
View in 3D
