| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (55 species) not a true protein |
| Species Clostridium acetobutylicum [TaxId:1488] [189302] (1 PDB entry) |
| Domain d3mc1b_: 3mc1 B: [181002] Other proteins in same PDB: d3mc1a2 automated match to d2ah5a1 complexed with cl, gol, na |
PDB Entry: 3mc1 (more details), 1.93 Å
SCOPe Domain Sequences for d3mc1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mc1b_ c.108.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
ynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyynfde
etatvaidyyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqilehf
klafyfdaivgssldgklstkedviryameslniksddaimigdreydvigalknnlpsi
gvtygfgsyeelknaganyivnsvdelhkkilelr
Timeline for d3mc1b_: