Lineage for d3m9za_ (3m9z A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235708Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)
  8. 2235716Domain d3m9za_: 3m9z A: [180980]
    automated match to d1ypoa1
    complexed with po4

Details for d3m9za_

PDB Entry: 3m9z (more details), 1.7 Å

PDB Description: Crystal Structure of extracellular domain of mouse NKR-P1A
PDB Compounds: (A:) Killer cell lectin-like receptor subfamily B member 1A

SCOPe Domain Sequences for d3m9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m9za_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekyns
fwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicq
kely

SCOPe Domain Coordinates for d3m9za_:

Click to download the PDB-style file with coordinates for d3m9za_.
(The format of our PDB-style files is described here.)

Timeline for d3m9za_: