Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries) |
Domain d3m5ib_: 3m5i B: [247611] Other proteins in same PDB: d3m5ia_, d3m5ic_, d3m5ie_ automated match to d4n5zb_ complexed with nag |
PDB Entry: 3m5i (more details), 3 Å
SCOPe Domain Sequences for d3m5ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5ib_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengweglingwygfrhqnaqgegtaadykstqsaidqitgklnrligktn qqfelidnefneieqqignvinwtrdamteiwsynaellvamenqhtidladsemsklye rvkkqlrenaeedgtgcfeifhkcddqcmesirnntydhtqyrteslqnriqids
Timeline for d3m5ib_: