Lineage for d3m3ca_ (3m3c A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.0: automated matches [191363] (1 protein)
not a true familyProtein automated matches [190437] (37 species)
not a true protein
Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries) 
Domain d3m3ca_: 3m3c A: [232870]
automated match to d1ww4a_
complexed with npo, so4
Details for d3m3ca_
PDB Entry: 3m3c (more details), 2 Å
PDB Description: crystal structure of agrocybe aegerita lectin aal complexed with p- nitrophenyl tf disaccharide
PDB Compounds: (A:) Anti-tumor lectinSCOPe Domain Sequences for d3m3ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ca_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla
SCOPe Domain Coordinates for d3m3ca_:
Click to download the PDB-style file with coordinates for d3m3ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3m3ca_:
- d3m3ca_ first appeared in SCOPe 2.03
- d3m3ca_ appears in SCOPe 2.04
- d3m3ca_ is called d3m3ca1 in SCOPe 2.06
- d3m3ca_ appears in the current release, SCOPe 2.08, called d3m3ca1
View in 3D
