Lineage for d3lzsa_ (3lzs A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (8 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (421 PDB entries)
Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
Domain d3lzsa_: 3lzs A: [180669]
automated match to d1a8ga_
complexed with 017, act
Details for d3lzsa_
PDB Entry: 3lzs (more details), 1.95 Å
PDB Description: crystal structure of hiv-1 crf01_ae protease in complex with darunavir
PDB Compounds: (A:) hiv-1 proteaseSCOPe Domain Sequences for d3lzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lzsa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrnmltqigctlnf
SCOPe Domain Coordinates for d3lzsa_:
Click to download the PDB-style file with coordinates for d3lzsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lzsa_:
- d3lzsa_ first appeared in SCOPe 2.01
- d3lzsa_ appears in SCOPe 2.02
- d3lzsa_ appears in SCOPe 2.04
- d3lzsa_ appears in the current release, SCOPe 2.08
View in 3D
