| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
| Protein automated matches [226931] (11 species) not a true protein |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries) |
| Domain d3lz9a1: 3lz9 A:15-220 [213103] Other proteins in same PDB: d3lz9a2 automated match to d1hxga1 complexed with fpf, mg; mutant |
PDB Entry: 3lz9 (more details), 2.28 Å
SCOPe Domain Sequences for d3lz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lz9a1 a.102.4.0 (A:15-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidti
erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng
kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal
eqclhkgvprvetrffissiydkeqs
Timeline for d3lz9a1: