Lineage for d3lz9a1 (3lz9 A:15-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722844Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2722845Protein automated matches [226931] (12 species)
    not a true protein
  7. 2722904Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries)
  8. 2722911Domain d3lz9a1: 3lz9 A:15-220 [213103]
    Other proteins in same PDB: d3lz9a2
    automated match to d1hxga1
    complexed with fpf, mg; mutant

Details for d3lz9a1

PDB Entry: 3lz9 (more details), 2.28 Å

PDB Description: the crystal structure of 5-epi-aristolochene synthase m4 mutant complexed with (2-trans,6-trans)-2-fluorofarnesyl diphosphate
PDB Compounds: (A:) Aristolochene synthase

SCOPe Domain Sequences for d3lz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lz9a1 a.102.4.0 (A:15-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidti
erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng
kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal
eqclhkgvprvetrffissiydkeqs

SCOPe Domain Coordinates for d3lz9a1:

Click to download the PDB-style file with coordinates for d3lz9a1.
(The format of our PDB-style files is described here.)

Timeline for d3lz9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lz9a2