Lineage for d3ly3a_ (3ly3 A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450242Protein beta-Lactamase, class A [56606] (16 species)
  7. 1450243Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries)
  8. 1450255Domain d3ly3a_: 3ly3 A: [180637]
    automated match to d2blma_

Details for d3ly3a_

PDB Entry: 3ly3 (more details), 1.8 Å

PDB Description: Crystal Structure of fluorophore-labeled Class A Beta-lactamase PenP
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3ly3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ly3a_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
rkigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmk
rnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvmkalnmn

SCOPe Domain Coordinates for d3ly3a_:

Click to download the PDB-style file with coordinates for d3ly3a_.
(The format of our PDB-style files is described here.)

Timeline for d3ly3a_: