Lineage for d3lvaa_ (3lva A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein automated matches [190406] (19 species)
not a true protein
Species Aequorea coerulescens [TaxId:210840] [189267] (7 PDB entries) 
Domain d3lvaa_: 3lva A: [180585]
automated match to d1qyoa_
complexed with gol, so4
Details for d3lvaa_
PDB Entry: 3lva (more details), 1.5 Å
PDB Description: crystal structure of colorless gfp-like protein from aequorea coerulescens
PDB Compounds: (A:) Green fluorescent proteinSCOPe Domain Sequences for d3lvaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lvaa_ d.22.1.1 (A:) automated matches {Aequorea coerulescens [TaxId: 210840]}
skgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlvn
rieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfgfvtaaaithgmdelyk
SCOPe Domain Coordinates for d3lvaa_:
Click to download the PDB-style file with coordinates for d3lvaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lvaa_:
- d3lvaa_ first appeared in SCOPe 2.01
- d3lvaa_ appears in SCOPe 2.07
View in 3D
