Lineage for d3ltla_ (3ltl A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (2 families) 
Family a.118.3.0: automated matches [191673] (1 protein)
not a true familyProtein automated matches [191283] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries) 
Domain d3ltla_: 3ltl A: [180557]
automated match to d1bc9a_
complexed with acy, ca
Details for d3ltla_
PDB Entry: 3ltl (more details), 2.2 Å
PDB Description: Crystal structure of human BIG1 Sec7 domain
PDB Compounds: (A:) Brefeldin A-inhibited guanine nucleotide-exchange protein 1SCOPe Domain Sequences for d3ltla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltla_ a.118.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqqkeiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqeerldstqvgeflgd
ndkfnkevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrlmekfaarylecnqg
qtlfasadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylsaiy
neiagkkismk
SCOPe Domain Coordinates for d3ltla_:
Click to download the PDB-style file with coordinates for d3ltla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ltla_:
- d3ltla_ first appeared in SCOPe 2.01
- d3ltla_ appears in SCOPe 2.07
View in 3D
