| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (24 species) not a true protein |
| Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [189514] (1 PDB entry) |
| Domain d3lrpa_: 3lrp A: [180532] automated match to d1hura_ complexed with gdp, mg, so4 |
PDB Entry: 3lrp (more details), 2.5 Å
SCOPe Domain Sequences for d3lrpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lrpa_ c.37.1.8 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mglyvsrlfnrlfqkkdvrilmvgldaagkttilykvklgevvttiptigfnvetvefrn
isftvwdvggqdkirplwrhyysntdglifvvdsndreriddareelhrmineeelkdai
ilvfankqdlpnamsaaevteklhlntirernwfiqstcatrgdglyegfdwltthlnna
k
Timeline for d3lrpa_: