| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Lepus europaeus [TaxId:9983] [189630] (1 PDB entry) |
| Domain d3lqda_: 3lqd A: [180505] automated match to d1bz1a_ complexed with hem, oxy |
PDB Entry: 3lqd (more details), 2.8 Å
SCOPe Domain Sequences for d3lqda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lqda_ a.1.1.2 (A:) automated matches {Lepus europaeus [TaxId: 9983]}
vlspadktniktawekigshggeygaeavermflgfpttktyfphfdfthgseqikahgk
kvsealtkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlanhhpseftpa
vhasldkflanvstvltskyr
Timeline for d3lqda_: